PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016469443.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 390aa    MW: 45134.8 Da    PI: 9.9336
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016469443.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3482.3e-151694999
                    HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  9 dvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                      +k++ l +pk f+ ++ +g ++e     +  + +++W vkl  ++++    l++GW++F++++gL+ gD ++F+++g++ef   v++f++
  XP_016469443.1 16 PGFKHA-LKIPKGFL-KYlKGHEHE---HAVLRRGSKKWLVKL--NGQR----LEEGWEKFAEEHGLQLGDLLIFRHEGEMEF--EVTIFDS 94
                    556666.********.564666444...56777899*******..8887....***********************9999999..9999986 PP

2B344.33.3e-14140221589
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     +++s+ ++++ ++lp kf++++g+k+++   l+++ e+ rsW++kl    + +++++++ W eF +an++k+gD ++F+++ + e
  XP_016469443.1 140 TVRSYCFSKSYFRLPGKFTKANGLKNKK-CGLIIRGERQRSWNLKL--YTSYSQVYIGGKWGEFRDANDIKVGDRIMFEVVANGE 221
                     578999****************777544.47999************..66667889***********************887533 PP

3B355.88.1e-18286372596
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     ++++++l+++ l++p +fa++hg+  ++  t++++d + rsW+++l    ++  +++++GW++F+ an LkegD v+F  +  +++++ +k+
  XP_016469443.1 286 TMKPYYLSKHFLRVPSPFARQHGLRDRK-CTIMIRD-EQRSWTFTL--YSCGTVTYIGGGWRDFCIANCLKEGDRVMFGIVA-NGEKPILKF 372
                     57899999999***********999766.5999999.779******..888888*************************876.555566665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.1E-22497IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.34E-20597IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.449795IPR003340B3 DNA binding domain
CDDcd100179.16E-16893No hitNo description
SMARTSM010193.0E-171095IPR003340B3 DNA binding domain
PfamPF023621.5E-111994IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.7E-13134227IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.39E-14136227IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.771136230IPR003340B3 DNA binding domain
SMARTSM010199.2E-9136233IPR003340B3 DNA binding domain
PfamPF023621.4E-12140222IPR003340B3 DNA binding domain
CDDcd100172.04E-10142215No hitNo description
SuperFamilySSF1019367.85E-20278372IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.3E-19279372IPR015300DNA-binding pseudobarrel domain
CDDcd100176.33E-15281374No hitNo description
PROSITE profilePS5086311.392282375IPR003340B3 DNA binding domain
SMARTSM010197.0E-15283376IPR003340B3 DNA binding domain
PfamPF023623.7E-15286373IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MKVRPAKPHF FKPILPGFKH ALKIPKGFLK YLKGHEHEHA VLRRGSKKWL VKLNGQRLEE  60
GWEKFAEEHG LQLGDLLIFR HEGEMEFEVT IFDSSHCDRE YAEYLQDEED AHTVKDPSKK  120
FEIKEAAPQN PIGQSHVVCT VRSYCFSKSY FRLPGKFTKA NGLKNKKCGL IIRGERQRSW  180
NLKLYTSYSQ VYIGGKWGEF RDANDIKVGD RIMFEVVANG ERPIWKFHHL RKNASLQPEG  240
MKTNSDTERV STPEKPKSNT ISSREAVPNV EAAKDMHLGH PHFICTMKPY YLSKHFLRVP  300
SPFARQHGLR DRKCTIMIRD EQRSWTFTLY SCGTVTYIGG GWRDFCIANC LKEGDRVMFG  360
IVANGEKPIL KFHDLRGNAS LQPERFHSRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016469443.10.0PREDICTED: B3 domain-containing protein REM10-like isoform X3
TrEMBLM1AKH21e-176M1AKH2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000246731e-175(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.16e-49B3 family protein